Recombinant Human ZNF146 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : ZNF146-316H
Product Overview : ZNF146 MS Standard C13 and N15-labeled recombinant protein (NP_009076) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : ZNF146 (Zinc Finger Protein 146) is a Protein Coding gene. Diseases associated with ZNF146 include Verrucous Papilloma. An important paralog of this gene is ZNF260.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 33.1 kDa
AA Sequence : MSHLSQQKIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVIKHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQRTHTGEKPFVCKECGKTFSGKSNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKAFSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZNF146 zinc finger protein 146 [ Homo sapiens (human) ]
Official Symbol ZNF146
Synonyms ZNF146; zinc finger protein 146; zinc finger protein OZF; OZF; only zinc finger protein; MGC125660; MGC125661;
Gene ID 7705
mRNA Refseq NM_007145
Protein Refseq NP_009076
MIM 601505
UniProt ID Q15072

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZNF146 Products

Required fields are marked with *

My Review for All ZNF146 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon