Recombinant Human ZMAT5 Protein (1-170 aa), His-SUMO-tagged

• Cat.No.: ZMAT5-1122H
• Product Overview: Recombinant Human ZMAT5 Protein (1-170 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-170 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 36.0 kDa
• AA Sequence: MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: ZMAT5 zinc finger, matrin-type 5 [ Homo sapiens ]
• Official Symbol: ZMAT5
• Synonyms: ZMAT5; U11/U12-20K; zinc finger, matrin type 5
• Gene ID: 55954
• mRNA Refseq: NM_001003692
• Protein Refseq: NP_001003692
• UniProt ID: Q9UDW3