Recombinant Human Zinc Finger Protein 259, GST-Tagged

• Cat.No.: ZNF259-6946H
• Product Overview: HumanZNF259 recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Zinc finger proteinZPR1 is a protein that in humans is encoded by the ZNF259 gene
• MW: 36.63 kDa
• Purity: GlutathioneSepharose 4 Fast Flow
• Sequence: IRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR
• Buffer: 50 mMTris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
• Storage: Store at-80°C. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ZNF259zinc finger protein 259 [ Homo sapiens ]
• Official Symbol: ZNF259
• Synonyms: ZNF259; zinc finger protein 259;zinc finger protein ZPR1; ZPR1
• Gene ID: 8882
• mRNA Refseq: NM_003904
• Protein Refseq: NP_003895
• MIM: 603901
• Uniprot ID: O75312
• Chromosome Location: 11q23.3
• Pathway: EGFR1 Signaling Pathway,organism-specific biosystem
• Function: metal ion binding; zinc ion binding