Recombinant Human Zinc Finger Protein 259, GST-Tagged

Cat.No. : ZNF259-6946H
Product Overview : HumanZNF259 recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Zinc finger proteinZPR1 is a protein that in humans is encoded by the ZNF259 gene
MW : 36.63 kDa
Purity : GlutathioneSepharose 4 Fast Flow
Sequence : IRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR
Buffer : 50 mMTris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
Storage : Store at-80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name ZNF259zinc finger protein 259 [ Homo sapiens ]
Official Symbol ZNF259
Synonyms ZNF259; zinc finger protein 259;zinc finger protein ZPR1; ZPR1
Gene ID 8882
mRNA Refseq NM_003904
Protein Refseq NP_003895
MIM 603901
Uniprot ID O75312
Chromosome Location 11q23.3
Pathway EGFR1 Signaling Pathway,organism-specific biosystem
Function metal ion binding; zinc ion binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZNF259 Products

Required fields are marked with *

My Review for All ZNF259 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon