Recombinant Human Zinc Finger Protein 259, GST-Tagged
Cat.No. : | ZNF259-6946H |
Product Overview : | HumanZNF259 recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Cat. No. : | ZNF259-6946H |
Description : | Zinc finger proteinZPR1 is a protein that in humans is encoded by the ZNF259 gene |
Host : | in vitrowheat germ expression system |
MW : | 36.63 kDa |
Purity : | GlutathioneSepharose 4 Fast Flow |
Sequence : | IRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR |
Buffer : | 50 mMTris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer |
Storage : | Store at-80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ZNF259zinc finger protein 259 [ Homo sapiens ] |
Official Symbol | ZNF259 |
Synonyms | ZNF259; zinc finger protein 259;zinc finger protein ZPR1; ZPR1 |
Gene ID | 8882 |
mRNA Refseq | NM_003904 |
Protein Refseq | NP_003895 |
MIM | 603901 |
Uniprot ID | O75312 |
Chromosome Location | 11q23.3 |
Pathway | EGFR1 Signaling Pathway,organism-specific biosystem |
Function | metal ion binding; zinc ion binding |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ZNF259 Products
Required fields are marked with *
My Review for All ZNF259 Products
Required fields are marked with *
0
Inquiry Basket