Recombinant Human ZG16, His-tagged

• Cat.No.: ZG16-202H
• Product Overview: Recombinant Human Zymogen Granule Membrane Protein 16/ZG16 is produced by our mammalian expression system. The target protein is expressed with sequence (Asn17-Cys167) of Human ZG16 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 17-167 a.a.
• Description: Zymogen Granule Membrane Protein 16 (ZG16) belongs to the jacalin lectin family. ZG16 is highly expressed in liver and is detected at lower levels in colon, ileum and jejunum. ZG16 may play a role in protein trafficking. In addition, ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
• AA Sequence: NAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNG DLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRS GSLIDAIGLHWDVYPTSCSRCVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.