Recombinant Human ZFP36

Cat.No. : ZFP36-31616TH
Product Overview : Recombinant full length Human Tristetraprolin (amino acids 1-326) with a proprietary tag at N-terminal: predicted molecular weight 61.93 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 326 amino acids
Description : Tristetraprolin (TTP) also known as zinc finger protein 36 homolog (ZFP36) is a protein that in humans is encoded by the ZFP36 gene.
Molecular Weight : 61.930kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
Sequence Similarities : Contains 2 C3H1-type zinc fingers.
Gene Name ZFP36 zinc finger protein 36, C3H type, homolog (mouse) [ Homo sapiens ]
Official Symbol ZFP36
Synonyms ZFP36; zinc finger protein 36, C3H type, homolog (mouse); zinc finger protein, C3H type, 36 homolog (mouse); tristetraprolin; G0S24; NUP475; RNF162A; TIS11; TTP;
Gene ID 7538
mRNA Refseq NM_003407
Protein Refseq NP_003398
MIM 190700
Uniprot ID P26651
Chromosome Location 19q13.1
Pathway Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Metabolism, organism-specific biosystem;
Function AU-rich element binding; DNA binding; mRNA binding; metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZFP36 Products

Required fields are marked with *

My Review for All ZFP36 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon