Recombinant Human ZFP36

• Cat.No.: ZFP36-31616TH
• Product Overview: Recombinant full length Human Tristetraprolin (amino acids 1-326) with a proprietary tag at N-terminal: predicted molecular weight 61.93 kDa.

Specification

• Description: Tristetraprolin (TTP) also known as zinc finger protein 36 homolog (ZFP36) is a protein that in humans is encoded by the ZFP36 gene.
• Protein length: 326 amino acids
• Molecular Weight: 61.930kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
• Sequence Similarities: Contains 2 C3H1-type zinc fingers.
• Tag: Non

Gene Information

• Gene Name: ZFP36 zinc finger protein 36, C3H type, homolog (mouse) [ Homo sapiens ]
• Official Symbol: ZFP36
• Synonyms: ZFP36; zinc finger protein 36, C3H type, homolog (mouse); zinc finger protein, C3H type, 36 homolog (mouse); tristetraprolin; G0S24; NUP475; RNF162A; TIS11; TTP
• Gene ID: 7538
• mRNA Refseq: NM_003407
• Protein Refseq: NP_003398
• MIM: 190700
• Uniprot ID: P26651
• Chromosome Location: 19q13.1
• Pathway: Destabilization of mRNA by Tristetraprolin (TTP), organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Metabolism, organism-specific biosystem
• Function: AU-rich element binding; DNA binding; mRNA binding; metal ion binding; protein binding