Recombinant Human ZCCHC24 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZCCHC24-4153H
• Product Overview: ZCCHC24 MS Standard C13 and N15-labeled recombinant protein (NP_699198) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ZCCHC24 (Zinc Finger CCHC-Type Containing 24) is a Protein Coding gene. Diseases associated with ZCCHC24 include Marshall-Smith Syndrome. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. An important paralog of this gene is RBBP6.
• Molecular Mass: 26.9 kDa
• AA Sequence: MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPVPTAGAAPPELAFGKGRPEQLGSPLHSSYLNSFFQLQRGEALSNSVYKGASPYGSLNNIADGLSSLTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZCCHC24 zinc finger CCHC-type containing 24 [ Homo sapiens (human) ]
• Official Symbol: ZCCHC24
• Synonyms: ZCCHC24; zinc finger CCHC-type containing 24; Z3CXXC8; C10orf56; zinc finger CCHC domain-containing protein 24; zinc finger, 3CxxC-type 8; zinc finger, CCHC domain containing 24
• Gene ID: 219654
• mRNA Refseq: NM_153367
• Protein Refseq: NP_699198
• UniProt ID: Q8N2G6