Recombinant Human ZCCHC13 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZCCHC13-3537H
• Product Overview: ZCCHC13 MS Standard C13 and N15-labeled recombinant protein (NP_976048) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 3. However, the CDS of this intronless gene remains relatively intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein. The encoded protein contains six CCHC-type zinc fingers, and is thus thought to function as a transcription factor.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 18 kDa
• AA Sequence: MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZCCHC13 zinc finger CCHC-type containing 13 [ Homo sapiens (human) ]
• Official Symbol: ZCCHC13
• Synonyms: ZCCHC13; zinc finger, CCHC domain containing 13; zinc finger CCHC domain-containing protein 13; 4930513O09RIK; Cnbp2; ZNF9L; CNBP2
• Gene ID: 389874
• mRNA Refseq: NM_203303
• Protein Refseq: NP_976048
• UniProt ID: Q8WW36