Recombinant Human ZC2HC1C Protein, GST-tagged

• Cat.No.: ZC2HC1C-3718H
• Product Overview: Human FAM164C full-length ORF ( NP_001035895.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ZC2HC1C (Zinc Finger C2HC-Type Containing 1C) is a Protein Coding gene. An important paralog of this gene is ZC2HC1B.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 57.4 kDa
• AA Sequence: MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYTHPKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLKPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ZC2HC1C zinc finger C2HC-type containing 1C [ Homo sapiens (human) ]
• Official Symbol: ZC2HC1C
• Synonyms: ZC2HC1C; zinc finger C2HC-type containing 1C; Zinc Finger C2HC-Type Containing 1C; Family With Sequence Similarity 164, Member C; C14orf140; FAM164C; Zinc Finger C2HC Domain-Containing Protein 1C; Chromosome 14 Open Reading Frame 140; Protein FAM164C; zinc finger C2HC domain-containing protein 1C; family with sequence similarity 164, member C; protein FAM164C
• Gene ID: 79696
• mRNA Refseq: NM_001042430
• Protein Refseq: NP_001035895
• UniProt ID: Q53FD0