Recombinant Human ZC2HC1B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZC2HC1B-3804H |
Product Overview : | C6orf94 MS Standard C13 and N15-labeled recombinant protein (NP_001013645) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ZC2HC1B (Zinc Finger C2HC-Type Containing 1B) is a Protein Coding gene. Diseases associated with ZC2HC1B include Transient Neonatal Diabetes Mellitus. An important paralog of this gene is ZC2HC1A. |
Molecular Mass : | 24.5 kDa |
AA Sequence : | MAGAEPFLADGNQELFPCEVCGRRFAADVLERHGPICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSKSPPVRKSNWRQQHEDFINAIRSAKQCMLAIKEGRPLPPPPPPSLNPDYIQRPYCMRRFNESAAERHTNFCKDQSSRRVFNPAQTAAKLASRAQGRAQMGPKKEPTVTSAVGALLQNRVLVATNEVPTKSGLAMDPASGAKLRQGFSKSSKKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZC2HC1B zinc finger C2HC-type containing 1B [ Homo sapiens (human) ] |
Official Symbol | ZC2HC1B |
Synonyms | ZC2HC1B; zinc finger C2HC-type containing 1B; C6orf94; FAM164B; dJ468K18.5; zinc finger C2HC domain-containing protein 1B; family with sequence similarity 164, member B; protein FAM164B |
Gene ID | 153918 |
mRNA Refseq | NM_001013623 |
Protein Refseq | NP_001013645 |
UniProt ID | Q5TFG8 |
◆ Recombinant Proteins | ||
ZC2HC1B-3804H | Recombinant Human ZC2HC1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Zc2hc1b-7057M | Recombinant Mouse Zc2hc1b Protein, Myc/DDK-tagged | +Inquiry |
ZC2HC1B-106H | Recombinant Human FAM164B Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZC2HC1B Products
Required fields are marked with *
My Review for All ZC2HC1B Products
Required fields are marked with *
0
Inquiry Basket