Recombinant Human ZC2HC1B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZC2HC1B-3804H
• Product Overview: C6orf94 MS Standard C13 and N15-labeled recombinant protein (NP_001013645) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: ZC2HC1B (Zinc Finger C2HC-Type Containing 1B) is a Protein Coding gene. Diseases associated with ZC2HC1B include Transient Neonatal Diabetes Mellitus. An important paralog of this gene is ZC2HC1A.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 24.5 kDa
• AA Sequence: MAGAEPFLADGNQELFPCEVCGRRFAADVLERHGPICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSKSPPVRKSNWRQQHEDFINAIRSAKQCMLAIKEGRPLPPPPPPSLNPDYIQRPYCMRRFNESAAERHTNFCKDQSSRRVFNPAQTAAKLASRAQGRAQMGPKKEPTVTSAVGALLQNRVLVATNEVPTKSGLAMDPASGAKLRQGFSKSSKKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZC2HC1B zinc finger C2HC-type containing 1B [ Homo sapiens (human) ]
• Official Symbol: ZC2HC1B
• Synonyms: ZC2HC1B; zinc finger C2HC-type containing 1B; C6orf94; FAM164B; dJ468K18.5; zinc finger C2HC domain-containing protein 1B; family with sequence similarity 164, member B; protein FAM164B
• Gene ID: 153918
• mRNA Refseq: NM_001013623
• Protein Refseq: NP_001013645
• UniProt ID: Q5TFG8