Recombinant Human ZBTB9 Protein, HIS-tagged

Cat.No. : ZBTB9-088H
Product Overview : Recombinant Human ZBTB9 fused with His tag at C-termina was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : May be involved in transcriptional regulation.
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH7.4
Molecular Mass : 51.7kD
AA Sequence : METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQTPVQSSASTESPASTESPVGGEGSELGEVLQIQVEEEEEEEEDDDDEDQGSATLSQTPQPQRVSGVFPRPHGPHPLPM
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name ZBTB9 zinc finger and BTB domain containing 9 [ Homo sapiens ]
Official Symbol ZBTB9
Synonyms ZBTB9; zinc finger and BTB domain containing 9; zinc finger and BTB domain-containing protein 9; MGC23166; ZNF919;
Gene ID 221504
mRNA Refseq NM_152735
Protein Refseq NP_689948
UniProt ID Q96C00

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ZBTB9 Products

Required fields are marked with *

My Review for All ZBTB9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon