Recombinant Human ZBTB9 Protein, HIS-tagged
Cat.No. : | ZBTB9-088H |
Product Overview : | Recombinant Human ZBTB9 fused with His tag at C-termina was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | May be involved in transcriptional regulation. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH7.4 |
Molecular Mass : | 51.7kD |
AA Sequence : | METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQTPVQSSASTESPASTESPVGGEGSELGEVLQIQVEEEEEEEEDDDDEDQGSATLSQTPQPQRVSGVFPRPHGPHPLPM |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | ZBTB9 zinc finger and BTB domain containing 9 [ Homo sapiens ] |
Official Symbol | ZBTB9 |
Synonyms | ZBTB9; zinc finger and BTB domain containing 9; zinc finger and BTB domain-containing protein 9; MGC23166; ZNF919; |
Gene ID | 221504 |
mRNA Refseq | NM_152735 |
Protein Refseq | NP_689948 |
UniProt ID | Q96C00 |
◆ Recombinant Proteins | ||
ZBTB9-089H | Recombinant Human ZBTB9 Protein, GST-HIS-tagged | +Inquiry |
ZBTB9-18736M | Recombinant Mouse ZBTB9 Protein | +Inquiry |
ZBTB9-10291M | Recombinant Mouse ZBTB9 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZBTB9-088H | Recombinant Human ZBTB9 Protein, HIS-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB9-209HCL | Recombinant Human ZBTB9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZBTB9 Products
Required fields are marked with *
My Review for All ZBTB9 Products
Required fields are marked with *
0
Inquiry Basket