Recombinant Human YWHAZ protein, T7/His-tagged
Cat.No. : | YWHAZ-203H |
Product Overview : | Recombinant human 14-3-3 zeta cDNA (244aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 244 a.a. |
Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVA YKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMK GDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFD EAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [ Homo sapiens ] |
Official Symbol | YWHAZ |
Synonyms | YWHAZ; 14 3 3 delta; 14 3 3 zeta; KCIP 1; 14-3-3 zeta; 14-3-3 delta; phospholipase A2; protein kinase C inhibitor protein 1; YWHAD; KCIP-1; 14-3-3-zeta; MGC111427; MGC126532; MGC138156; |
Gene ID | 7534 |
mRNA Refseq | NM_001135699 |
Protein Refseq | NP_001129171 |
MIM | 601288 |
UniProt ID | P63104 |
Chromosome Location | 8q22.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; |
Function | protein binding; protein domain specific binding; transcription factor binding; |
◆ Recombinant Proteins | ||
YWHAZ-5062R | Recombinant Rhesus Macaque YWHAZ Protein, His (Fc)-Avi-tagged | +Inquiry |
YWHAZ-4900H | Recombinant Human Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, Zeta Polypeptide, GST-tagged | +Inquiry |
YWHAZ-5249R | Recombinant Rhesus monkey YWHAZ Protein, His-tagged | +Inquiry |
YWHAZ-3779H | Recombinant Human YWHAZ protein, His-GST-tagged | +Inquiry |
Ywhaz-152M | Recombinant Mouse Ywhaz Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAZ-229HCL | Recombinant Human YWHAZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YWHAZ Products
Required fields are marked with *
My Review for All YWHAZ Products
Required fields are marked with *
0
Inquiry Basket