Recombinant Human YWHAZ protein, T7/His-tagged

Cat.No. : YWHAZ-203H
Product Overview : Recombinant human 14-3-3 zeta cDNA (244aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 244 a.a.
Form : 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVA YKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMK GDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFD EAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [ Homo sapiens ]
Official Symbol YWHAZ
Synonyms YWHAZ; 14 3 3 delta; 14 3 3 zeta; KCIP 1; 14-3-3 zeta; 14-3-3 delta; phospholipase A2; protein kinase C inhibitor protein 1; YWHAD; KCIP-1; 14-3-3-zeta; MGC111427; MGC126532; MGC138156;
Gene ID 7534
mRNA Refseq NM_001135699
Protein Refseq NP_001129171
MIM 601288
UniProt ID P63104
Chromosome Location 8q22.3
Pathway Adaptive Immune System, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem;
Function protein binding; protein domain specific binding; transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All YWHAZ Products

Required fields are marked with *

My Review for All YWHAZ Products

Required fields are marked with *

0

Inquiry Basket

cartIcon