Recombinant Human YWHAZ protein, His-GST-tagged

Cat.No. : YWHAZ-3779H
Product Overview : Recombinant Human YWHAZ protein(P63104)(133-212aa), fused to N-terminal His-GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 133-212aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 40.6 kDa
AA Sequence : AAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [ Homo sapiens ]
Official Symbol YWHAZ
Synonyms YWHAZ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, delta polypeptide , YWHAD; 14-3-3 protein zeta/delta; 14 3 3 delta; 14 3 3 zeta; KCIP 1; 14-3-3 zeta; 14-3-3 delta; phospholipase A2; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; 14-3-3 protein/cytosolic phospholipase A2; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; YWHAD; KCIP-1; 14-3-3-zeta; MGC111427; MGC126532; MGC138156;
Gene ID 7534
mRNA Refseq NM_001135699
Protein Refseq NP_001129171
MIM 601288
UniProt ID P63104

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All YWHAZ Products

Required fields are marked with *

My Review for All YWHAZ Products

Required fields are marked with *

0

Inquiry Basket

cartIcon