Recombinant Human YWHAZ protein, His-GST-tagged

• Cat.No.: YWHAZ-3779H
• Product Overview: Recombinant Human YWHAZ protein(P63104)(133-212aa), fused to N-terminal His-GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.6 kDa
• Protein length: 133-212aa
• AA Sequence: AAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [ Homo sapiens ]
• Official Symbol: YWHAZ
• Synonyms: YWHAZ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein, delta polypeptide , YWHAD; 14-3-3 protein zeta/delta; 14 3 3 delta; 14 3 3 zeta; KCIP 1; 14-3-3 zeta; 14-3-3 delta; phospholipase A2; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; 14-3-3 protein/cytosolic phospholipase A2; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; YWHAD; KCIP-1; 14-3-3-zeta; MGC111427; MGC126532; MGC138156
• Gene ID: 7534
• mRNA Refseq: NM_001135699
• Protein Refseq: NP_001129171
• MIM: 601288
• UniProt ID: P63104