Recombinant Full Length Human YWHAZ Protein, C-Flag-tagged

• Cat.No.: YWHAZ-467HFL
• Product Overview: Recombinant Full Length Human YWHAZ Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 27.6 kDa
• AA Sequence: MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES
  YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGENTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis, Pathogenic Escherichia coli infection
• Full Length: Full L.

Gene Information

• Gene Name: YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta [ Homo sapiens (human) ]
• Official Symbol: YWHAZ
• Synonyms: HEL4; YWHAD; KCIP-1; HEL-S-3; POPCHAS; HEL-S-93; 14-3-3-zeta
• Gene ID: 7534
• mRNA Refseq: NM_001135699.2
• Protein Refseq: NP_001129171.1
• MIM: 601288
• UniProt ID: P63104