Recombinant Full Length Human YWHAZ Protein, C-Flag-tagged
Cat.No. : | YWHAZ-467HFL |
Product Overview : | Recombinant Full Length Human YWHAZ Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.6 kDa |
AA Sequence : | MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTE GAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKG IVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEES YKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis, Pathogenic Escherichia coli infection |
Full Length : | Full L. |
Gene Name | YWHAZ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta [ Homo sapiens (human) ] |
Official Symbol | YWHAZ |
Synonyms | HEL4; YWHAD; KCIP-1; HEL-S-3; POPCHAS; HEL-S-93; 14-3-3-zeta |
Gene ID | 7534 |
mRNA Refseq | NM_001135699.2 |
Protein Refseq | NP_001129171.1 |
MIM | 601288 |
UniProt ID | P63104 |
◆ Recombinant Proteins | ||
YWHAZ-3779H | Recombinant Human YWHAZ protein, His-GST-tagged | +Inquiry |
YWHAZ-104H | Recombinant Human Tyrosine 3-monooxygenase/ Tryptophan 5-monooxygenase Activation Protein, Zeta Polypeptide, His-tagged | +Inquiry |
YWHAZ-843H | Recombinant Human YWHAZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YWHAZ-12027Z | Recombinant Zebrafish YWHAZ | +Inquiry |
YWHAZ-5062R | Recombinant Rhesus Macaque YWHAZ Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAZ-229HCL | Recombinant Human YWHAZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YWHAZ Products
Required fields are marked with *
My Review for All YWHAZ Products
Required fields are marked with *
0
Inquiry Basket