Recombinant Human YWHAH, His-tagged

• Cat.No.: YWHAH-26005TH
• Product Overview: Recombinant full length protein corresponding to amino acids 1 - 246 of Human 14-3-3 eta; with an N-terminal his tag; predicted MWt 31.7 kDa inclusive of tag.Residue M35 of the fusion protein is equivalent to M1 of the native protein. The His(6) tag is lo

Specification

• Description: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5 UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder.
• Protein length: 246 amino acids
• Conjugation: HIS
• Molecular Weight: 31.700kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Expressed mainly in the brain and present in other tissues albeit at lower levels.
• Form: Liquid
• Purity: Purified via His tag
• Storage buffer: pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.012% Benzamidine, 0.003% PMSF
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMGDREQ LLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLS VAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYR EKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKM KGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQ PTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIA ELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
• Sequence Similarities: Belongs to the 14-3-3 family.

Gene Information

• Gene Name: YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide [ Homo sapiens ]
• Official Symbol: YWHAH
• Synonyms: YWHAH; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide; YWHA1; 14-3-3 protein eta; 14 3 3 eta
• Gene ID: 7533
• mRNA Refseq: NM_003405
• Protein Refseq: NP_003396
• MIM: 113508
• Uniprot ID: Q04917
• Chromosome Location: 22q12.1-q13.1
• Pathway: Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem
• Function: actin binding; enzyme binding; glucocorticoid receptor binding; insulin-like growth factor receptor binding; protein binding