Recombinant Full Length Human YWHAH Protein, C-Flag-tagged

• Cat.No.: YWHAH-922HFL
• Product Overview: Recombinant Full Length Human YWHAH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 28 kDa
• AA Sequence: MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT
  LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis
• Full Length: Full L.

Gene Information

• Gene Name: YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta [ Homo sapiens (human) ]
• Official Symbol: YWHAH
• Synonyms: YWHA1
• Gene ID: 7533
• mRNA Refseq: NM_003405.4
• Protein Refseq: NP_003396.1
• MIM: 113508
• UniProt ID: Q04917