Recombinant Full Length Human YWHAH Protein, C-Flag-tagged
Cat.No. : | YWHAH-922HFL |
Product Overview : | Recombinant Full Length Human YWHAH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28 kDa |
AA Sequence : | MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Full Length : | Full L. |
Gene Name | YWHAH tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta [ Homo sapiens (human) ] |
Official Symbol | YWHAH |
Synonyms | YWHA1 |
Gene ID | 7533 |
mRNA Refseq | NM_003405.4 |
Protein Refseq | NP_003396.1 |
MIM | 113508 |
UniProt ID | Q04917 |
◆ Recombinant Proteins | ||
YWHAH-18685M | Recombinant Mouse YWHAH Protein | +Inquiry |
YWHAH-6640R | Recombinant Rat YWHAH Protein | +Inquiry |
YWHAH-26007TH | Recombinant Human YWHAH, His-tagged | +Inquiry |
YWHAH-871H | Recombinant Human YWHAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YWHAH-4250H | Recombinant Human YWHAH protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAH-231HCL | Recombinant Human YWHAH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YWHAH Products
Required fields are marked with *
My Review for All YWHAH Products
Required fields are marked with *
0
Inquiry Basket