Recombinant Human YWHAG, His-tagged

Description :	This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways.
Protein length :	247 amino acids
Conjugation :	HIS
Molecular Weight :	31.800kDa inclusive of tags
Source :	E. coli
Tissue specificity :	Highly expressed in brain, skeletal muscle, and heart.
Form :	Liquid
Purity :	Purified via His tag
Storage buffer :	pH: 7.50Constituents:0.6% HEPES, 0.02% DTT, 50% Glycerol, 0.012% Benzamidine, 0.003% PMSF
Storage :	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids :	MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVDREQ LVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLS VAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYR EKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKM KGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQ PTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIA ELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGN N
Sequence Similarities :	Belongs to the 14-3-3 family.

Gene Name	YWHAG tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide [ Homo sapiens ]
Official Symbol	YWHAG
Synonyms	YWHAG; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; 14-3-3 protein gamma; 14 3 3 gamma;
Gene ID	7532
mRNA Refseq	NM_012479
Protein Refseq	NP_036611
MIM	605356
Uniprot ID	P61981
Chromosome Location	7q11.23
Pathway	Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem;
Function	insulin-like growth factor receptor binding; protein binding; protein domain specific binding; protein kinase C binding; protein kinase C inhibitor activity;

COA

Cat.No. :	YWHAG-26009TH
Product Overview :	Recombinant full length protein corresponding to amino acids 1-247 of Human 14-3-3 gamma, with an N-terminal His tag; predicted MWt 31.8 kDa inclusive of tag.Residue M35 of the fusion protein is equivalent to M1 of the native protein. The His(6) tag is lo