Recombinant Human YWHAE protein, His-tagged

Cat.No. : YWHAE-2595H
Product Overview : Recombinant Human YWHAE protein(1-255 aa), fused to His tag, was expressed in E. coli.
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Protein length : 1-255 aa
AA Sequence : MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide [ Homo sapiens ]
Official Symbol YWHAE
Synonyms YWHAE; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide; 14-3-3 protein epsilon; 14 3 3 epsilon; FLJ45465; 14-3-3 epsilon; protein kinase C inhibitor protein-1; mitochondrial import stimulation factor L subunit; tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide; MDS; MDCR; KCIP-1; 14-3-3E; FLJ53559;
Gene ID 7531
mRNA Refseq NM_006761
Protein Refseq NP_006752
MIM 605066
UniProt ID P62258

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All YWHAE Products

Required fields are marked with *

My Review for All YWHAE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon