Recombinant Human YPEL4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: YPEL4-4092H
• Product Overview: YPEL4 MS Standard C13 and N15-labeled recombinant protein (NP_659445) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: YPEL4 (Yippee Like 4) is a Protein Coding gene. An important paralog of this gene is YPEL3.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.3 kDa
• AA Sequence: MPSCDPGPGPACLPTKTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVGCGPAEQRLLLTGLHSVADIFCESCKTTLGWKYEQAFETSQKYKEGKYIIEMSHMVKDNGWDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: YPEL4 yippee like 4 [ Homo sapiens (human) ]
• Official Symbol: YPEL4
• Synonyms: YPEL4; yippee like 4; protein yippee-like 4
• Gene ID: 219539
• mRNA Refseq: NM_145008
• Protein Refseq: NP_659445
• MIM: 609725
• UniProt ID: Q96NS1