Recombinant Human YPEL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: YPEL1-3086H
• Product Overview: YPEL1 MS Standard C13 and N15-labeled recombinant protein (NP_037445) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene is located in the region associated with DiGeorge syndrome on chromosome 22. The encoded protein localizes to the centrosome and nucleolus and may play a role in the regulation of cell division.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13.6 kDa
• AA Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: YPEL1 yippee like 1 [ Homo sapiens (human) ]
• Official Symbol: YPEL1
• Synonyms: YPEL1; yippee like 1; FKSG3; protein yippee-like 1; DiGeorge syndrome-related protein
• Gene ID: 29799
• mRNA Refseq: NM_013313
• Protein Refseq: NP_037445
• MIM: 608082
• UniProt ID: O60688