Recombinant Human YES proto oncogene 1, Src family tyrosine kinase Protein, His tagged
Cat.No. : | YES1-001H |
Product Overview : | Recombinant Human YES1 Protein with His tag was expressed in E. coli. |
Availability | March 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-88 aa |
Description : | This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. |
Tag : | C-His |
Molecular Mass : | 10 kDa |
AA Sequence : | MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSVVPSSYPAGHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 80% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.8 mg/mL by BCA |
Gene Name | YES1 YES proto-oncogene 1, Src family tyrosine kinase [ Homo sapiens (human) ] |
Official Symbol | YES1 |
Synonyms | YES1; v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1; tyrosine-protein kinase Yes; c yes; HsT441; Yes; proto-oncogene c-Yes; cellular yes-1 protein; Yamaguchi sarcoma oncogene; proto-oncogene tyrosine-protein kinase YES; c-yes; P61-YES |
Gene ID | 7525 |
mRNA Refseq | NM_005433 |
Protein Refseq | NP_005424 |
MIM | 164880 |
UniProt ID | P07947 |
◆ Recombinant Proteins | ||
YES1-10253M | Recombinant Mouse YES1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YES1-1102HFL | Recombinant Full Length Human YES1 Protein, C-Flag-tagged | +Inquiry |
YES1-9947HF | Active Recombinant Full Length Human YES1 Protein, GST-tagged | +Inquiry |
YES1-5236R | Recombinant Rhesus monkey YES1 Protein, His-tagged | +Inquiry |
YES1-0737H | Recombinant Human YES1 Protein (G2-L543), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
YES1-620HCL | Recombinant Human YES1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YES1 Products
Required fields are marked with *
My Review for All YES1 Products
Required fields are marked with *
0
Inquiry Basket