Recombinant Human YBX3 Protein, GST-tagged

• Cat.No.: YBX3-1956H
• Product Overview: Human CSDA full-length ORF (BAG37363.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: YBX3 (Y-Box Binding Protein 3) is a Protein Coding gene. Diseases associated with YBX3 include Lyme Disease and Uterine Inflammatory Disease. Among its related pathways are Cytoskeleton remodeling Regulation of actin cytoskeleton by Rho GTPases and Sertoli-Sertoli Cell Junction Dynamics. GO annotations related to this gene include nucleic acid binding and transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is YBX1.
• Molecular Mass: 67.32 kDa
• AA Sequence: MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: YBX3 Y-box binding protein 3 [ Homo sapiens (human) ]
• Official Symbol: YBX3
• Synonyms: YBX3; Y-box binding protein 3; CSDA; cold shock domain protein A; DNA-binding protein A; cold shock domain containing A1; CSDA1; dbpA; ZONAB; cold-shock domain protein A; cold-shock domain containing A1; cold shock domain-containing protein A; single-strand DNA-binding protein NF-GMB; ZO-1-associated nucleic acid-binding protein; DBPA
• Gene ID: 8531
• mRNA Refseq: NM_001145426
• Protein Refseq: NP_001138898
• MIM: 603437
• UniProt ID: P16989