Recombinant Human YBX3 Protein, GST-tagged
Cat.No. : | YBX3-1956H |
Product Overview : | Human CSDA full-length ORF (BAG37363.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-372 aa |
Description : | YBX3 (Y-Box Binding Protein 3) is a Protein Coding gene. Diseases associated with YBX3 include Lyme Disease and Uterine Inflammatory Disease. Among its related pathways are Cytoskeleton remodeling Regulation of actin cytoskeleton by Rho GTPases and Sertoli-Sertoli Cell Junction Dynamics. GO annotations related to this gene include nucleic acid binding and transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is YBX1. |
Molecular Mass : | 67.32 kDa |
AA Sequence : | MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | YBX3 Y-box binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | YBX3 |
Synonyms | YBX3; Y-box binding protein 3; CSDA; cold shock domain protein A; DNA-binding protein A; cold shock domain containing A1; CSDA1; dbpA; ZONAB; cold-shock domain protein A; cold-shock domain containing A1; cold shock domain-containing protein A; single-strand DNA-binding protein NF-GMB; ZO-1-associated nucleic acid-binding protein; DBPA; |
Gene ID | 8531 |
mRNA Refseq | NM_001145426 |
Protein Refseq | NP_001138898 |
MIM | 603437 |
UniProt ID | P16989 |
◆ Recombinant Proteins | ||
YBX3-6957C | Recombinant Chicken YBX3 | +Inquiry |
YBX3-1956H | Recombinant Human YBX3 Protein, GST-tagged | +Inquiry |
YBX3-155H | Recombinant Human CSDA Protein, MYC/DDK-tagged | +Inquiry |
YBX3-2150HF | Recombinant Full Length Human YBX3 Protein, GST-tagged | +Inquiry |
Ybx3-7030M | Recombinant Mouse Ybx3 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YBX3 Products
Required fields are marked with *
My Review for All YBX3 Products
Required fields are marked with *
0
Inquiry Basket