Recombinant Human YARS protein, T7/His-tagged
Cat.No. : | YARS-207H |
Product Overview : | Recombinant human YARS N-terminal fragment (Mini-TyrRA) cDNA (2 – 364 aa, derived from BC016689) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 2-364 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGK PHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTD YQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEK YLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLK SEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQ KPMAKGPAKNSEPEEVI |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro Mini-YARS protein mediated interleukine-8 like activities regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for Mini-YARS protein – protein interaction assay.3. As Enzymatic substrate for various proteases.4. May be used for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | YARS tyrosyl-tRNA synthetase [ Homo sapiens ] |
Official Symbol | YARS |
Synonyms | YARS; tyrosyl-tRNA synthetase; tyrosine--tRNA ligase, cytoplasmic; tyrosine tRNA ligase 1; cytoplasmic; tyrRS; YRS; YTS; tyrosyl--tRNA ligase; tyrosine tRNA ligase 1, cytoplasmic; tyrosyl-tRNA synthetase, cytoplasmic; TYRRS; CMTDIC; |
Gene ID | 8565 |
mRNA Refseq | NM_003680 |
Protein Refseq | NP_003671 |
MIM | 603623 |
UniProt ID | P54577 |
Chromosome Location | 1p35.1 |
Pathway | Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem; Gene Expression, organism-specific biosystem; tRNA Aminoacylation, organism-specific biosystem; |
Function | ATP binding; interleukin-8 receptor binding; ligase activity; nucleotide binding; signal transducer activity; tRNA binding; tyrosine-tRNA ligase activity; |
◆ Recombinant Proteins | ||
YARS-5224H | Recombinant Human YARS Protein (Gly2-Ser528), His tagged | +Inquiry |
YARS-6279R | Recombinant Rat YARS Protein, His (Fc)-Avi-tagged | +Inquiry |
YARS-6623R | Recombinant Rat YARS Protein | +Inquiry |
YARS-230H | Recombinant Human YARS protein, T7/His-tagged | +Inquiry |
YARS-207H | Recombinant Human YARS protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YARS-249HCL | Recombinant Human YARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YARS Products
Required fields are marked with *
My Review for All YARS Products
Required fields are marked with *
0
Inquiry Basket