Recombinant Human XRCC6, His-tagged

• Cat.No.: XRCC6-29198TH
• Product Overview: Recombinant fragment, corresponding to amino acids 334-609 of Human Ku70 with N terminal His tag; 276 amino acids, 36kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 334-609 a.a.
• Description: The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 69 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEES LVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFV ALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEK IMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRN LEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKE LVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTH ISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTK HFQD
• Sequence Similarities: Belongs to the ku70 family.Contains 1 Ku domain.Contains 1 SAP domain.

Gene Information

• Gene Name: XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 [ Homo sapiens ]
• Official Symbol: XRCC6
• Synonyms: XRCC6; X-ray repair complementing defective repair in Chinese hamster cells 6; G22P1, thyroid autoantigen 70kD (Ku antigen) , thyroid autoantigen 70kDa (Ku antigen); X-ray repair cross-complementing protein 6; D22S671; D22S731; Ku autoantigen; 70kDa; KU
• Gene ID: 2547
• mRNA Refseq: NM_001469
• Protein Refseq: NP_001460
• MIM: 152690
• Uniprot ID: P12956
• Chromosome Location: 22q13.2
• Pathway: 2-LTR circle formation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; DNA Repair, organism-specific biosystem; DNA-PK complex, organism-specific biosystem
• Function: 5-deoxyribose-5-phosphate lyase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; double-stranded DNA binding