Recombinant Human XPNPEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: XPNPEP1-5522H
• Product Overview: XPNPEP1 MS Standard C13 and N15-labeled recombinant protein (NP_065116) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes the cytosolic form of a metalloaminopeptidase that catalyzes the cleavage of the N-terminal amino acid adjacent to a proline residue. The gene product may play a role in degradation and maturation of tachykinins, neuropeptides, and peptide hormones. Alternative splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 69.9 kDa
• AA Sequence: MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: XPNPEP1 X-prolyl aminopeptidase 1 [ Homo sapiens (human) ]
• Official Symbol: XPNPEP1
• Synonyms: XPNPEP1; X-prolyl aminopeptidase (aminopeptidase P) 1, soluble; X prolyl aminopeptidase (aminopeptidase P) like, XPNPEP, XPNPEPL, XPNPEPL1; xaa-Pro aminopeptidase 1; X-Pro aminopeptidase 1; soluble aminopeptidase P; cytosolic aminopeptidase P; aminopeptidase P, cytosolic; aminoacylproline aminopeptidase; X-prolyl aminopeptidase 1, soluble; APP1; SAMP; XPNPEP; XPNPEPL; XPNPEPL1
• Gene ID: 7511
• mRNA Refseq: NM_020383
• Protein Refseq: NP_065116
• MIM: 602443
• UniProt ID: Q9NQW7