Recombinant Human XAGE3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: XAGE3-3833H
• Product Overview: XAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_573440) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is expressed in placenta and fetal liver/spleen, and may function in inhibiting cancer cell growth. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. Alternative splicing of this gene generates 2 transcript variants differing in the 5' UTR.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.3 kDa
• AA Sequence: MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADLQELSQSKTGGECGNGPDDQGKILPKSEQFKMPEGGDRQPQVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: XAGE3 X antigen family member 3 [ Homo sapiens (human) ]
• Official Symbol: XAGE3
• Synonyms: XAGE3; X antigen family member 3; PLAC6; GAGED4; XAGE-3; pp9012; CT12.3a; CT12.3b; X antigen family member 3; CT12.3; G antigen, family D, 4; cancer/testis antigen 12.3; cancer/testis antigen family 12, member 3a; cancer/testis antigen family 12, member 3b; g antigen family D member 4; placenta-specific 6; placenta-specific gene 6 protein; protein XAGE-3
• Gene ID: 170626
• mRNA Refseq: NM_133179
• Protein Refseq: NP_573440
• MIM: 300740
• UniProt ID: Q8WTP9