Recombinant Human XAGE2B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | XAGE2B-4841H |
Product Overview : | XAGE2B MS Standard C13 and N15-labeled recombinant protein (NP_001073006) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. |
Molecular Mass : | 12.4 kDa |
AA Sequence : | MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | XAGE2B X antigen family, member 2B [ Homo sapiens (human) ] |
Official Symbol | XAGE2B |
Synonyms | XAGE2B; X antigen family, member 2B; XAGE-2; X antigen family, member 2B; CT12.2; X antigen family member 2; cancer/testis antigen 12.2; g antigen family D member 3 |
Gene ID | 728242 |
mRNA Refseq | NM_001079538 |
Protein Refseq | NP_001073006 |
◆ Recombinant Proteins | ||
XAGE2B-3748H | Recombinant Human XAGE2B, His-tagged | +Inquiry |
XAGE2B-4841H | Recombinant Human XAGE2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
XAGE2B-269HCL | Recombinant Human XAGE2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XAGE2B Products
Required fields are marked with *
My Review for All XAGE2B Products
Required fields are marked with *
0
Inquiry Basket