Recombinant Human WTAP protein, T7-tagged

• Cat.No.: WTAP-186H
• Product Overview: Recombinant human WTAP (151aa, Isoform-II) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 151 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKL EQAQNELSAWKFTPDR
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: WTAP Wilms tumor 1 associated protein [ Homo sapiens ]
• Official Symbol: WTAP
• Synonyms: WTAP; Wilms tumor 1 associated protein; pre-mRNA-splicing regulator WTAP; KIAA0105; MGC3925; hFL(2)D; PNAS-132; WT1-associated protein; female-lethal(2)D homolog; wilms tumor 1-associating protein; Wilms tumour 1-associating protein; putative pre-mRNA splicing regulator female-lethal(2D); DKFZp686F20131
• Gene ID: 9589
• mRNA Refseq: NM_004906
• Protein Refseq: NP_004897
• MIM: 605442
• UniProt ID: Q15007
• Chromosome Location: 6q25-q27