Recombinant Human WNT8B, StrepII-tagged
Cat.No. : | WNT8B-210H |
Product Overview : | Purified, full-length human recombinant WNT8B protein (amino acids 23-351, 329 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 35.2 kDa. (Accession NP_003384.2; UniProt Q93098) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 23-351, 329 a.a. |
Description : | Wnt8b is a ligand for members of the frizzled family of seven transmembrane receptors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | WSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVM YTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAV KGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELV HLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCE QCRRRVTKYFCSRAERPRGGAAHKPGRKP |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | WNT8B wingless-type MMTV integration site family, member 8B [ Homo sapiens ] |
Official Symbol | WNT8B |
Synonyms | WNT8B; wingless-type MMTV integration site family, member 8B; protein Wnt-8b; |
Gene ID | 7479 |
mRNA Refseq | NM_003393 |
Protein Refseq | NP_003384 |
MIM | 601396 |
UniProt ID | Q93098 |
Chromosome Location | 10q24 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Hedgehog signaling pathway, organism-specific biosystem; |
Function | G-protein coupled receptor binding; |
◆ Recombinant Proteins | ||
Wnt8b-1051M | Recombinant Mouse Wnt8b Protein, His-SUMO/MYC-tagged | +Inquiry |
WNT8B-124H | Recombinant Human WNT8B Protein | +Inquiry |
WNT8B-3741H | Recombinant Human WNT8B, GST-tagged | +Inquiry |
WNT8B-8596Z | Recombinant Zebrafish WNT8B | +Inquiry |
Wnt8b-4960M | Recombinant Mouse Wnt8b protein, His-SUMO & Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT8B-286HCL | Recombinant Human WNT8B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT8B Products
Required fields are marked with *
My Review for All WNT8B Products
Required fields are marked with *
0
Inquiry Basket