Recombinant Human WNT8B, StrepII-tagged

• Cat.No.: WNT8B-210H
• Product Overview: Purified, full-length human recombinant WNT8B protein (amino acids 23-351, 329 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 35.2 kDa. (Accession NP_003384.2; UniProt Q93098)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 23-351, 329 a.a.
• Description: Wnt8b is a ligand for members of the frizzled family of seven transmembrane receptors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: WSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVM YTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAV KGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELV HLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCE QCRRRVTKYFCSRAERPRGGAAHKPGRKP
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: WNT8B wingless-type MMTV integration site family, member 8B [ Homo sapiens ]
• Official Symbol: WNT8B
• Synonyms: WNT8B; wingless-type MMTV integration site family, member 8B; protein Wnt-8b
• Gene ID: 7479
• mRNA Refseq: NM_003393
• Protein Refseq: NP_003384
• MIM: 601396
• UniProt ID: Q93098
• Chromosome Location: 10q24
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Hedgehog signaling pathway, organism-specific biosystem
• Function: G-protein coupled receptor binding