Recombinant Human WNT7A, StrepII-tagged
Cat.No. : | WNT7A-208H |
Product Overview : | Purified, full-length human recombinant WNT7A protein (amino acids 32-349, 318 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 35.6 kDa. (Accession NP_004616.2; UniProt O00755) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 32-349, 318 a.a. |
Description : | Wnt7a is a ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. Signaling by Wnt-7a allows sexually dimorphic development of the mullerian ducts. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | LGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAF TYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMN LHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKK PLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWC CYVKCNTCSERTEMYTCK |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | WNT7A wingless-type MMTV integration site family, member 7A [ Homo sapiens ] |
Official Symbol | WNT7A |
Synonyms | WNT7A; wingless-type MMTV integration site family, member 7A; protein Wnt-7a; proto oncogene Wnt7a protein; proto-oncogene Wnt7a protein; |
Gene ID | 7476 |
mRNA Refseq | NM_004625 |
Protein Refseq | NP_004616 |
MIM | 601570 |
UniProt ID | O00755 |
Chromosome Location | 3p25 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function | cytokine activity; frizzled binding; receptor agonist activity; receptor agonist activity; receptor binding; |
◆ Recombinant Proteins | ||
WNT7A-121H | Active Recombinant Human WNT7A Protein | +Inquiry |
WNT7A-5865C | Recombinant Chicken WNT7A | +Inquiry |
WNT7A-10201M | Recombinant Mouse WNT7A Protein, His (Fc)-Avi-tagged | +Inquiry |
WNT7A-898H | Active Recombinant Human WNT7A | +Inquiry |
WNT7A-1816M | Recombinant Mouse WNT7A protein(32-349aa), His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT7A-289HCL | Recombinant Human WNT7A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT7A Products
Required fields are marked with *
My Review for All WNT7A Products
Required fields are marked with *
0
Inquiry Basket