Recombinant Human WNT7A, StrepII-tagged

• Cat.No.: WNT7A-208H
• Product Overview: Purified, full-length human recombinant WNT7A protein (amino acids 32-349, 318 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 35.6 kDa. (Accession NP_004616.2; UniProt O00755)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 32-349, 318 a.a.
• Description: Wnt7a is a ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. Signaling by Wnt-7a allows sexually dimorphic development of the mullerian ducts.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: LGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAF TYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMN LHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKK PLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWC CYVKCNTCSERTEMYTCK
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: WNT7A wingless-type MMTV integration site family, member 7A [ Homo sapiens ]
• Official Symbol: WNT7A
• Synonyms: WNT7A; wingless-type MMTV integration site family, member 7A; protein Wnt-7a; proto oncogene Wnt7a protein; proto-oncogene Wnt7a protein
• Gene ID: 7476
• mRNA Refseq: NM_004625
• Protein Refseq: NP_004616
• MIM: 601570
• UniProt ID: O00755
• Chromosome Location: 3p25
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem
• Function: cytokine activity; frizzled binding; receptor agonist activity; receptor agonist activity; receptor binding