Recombinant Human WNT5A protein, His-tagged

• Cat.No.: WNT5A-5884H
• Product Overview: Recombinant Human WNT5A protein(Lys261-Val350), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: Lys261-Val350
• Form: Phosphate buffered saline
• Molecular Mass: 12 kDa
• AASequence: KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTV
• Storage: Store at -20°C/-80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: WNT5A wingless-type MMTV integration site family, member 5A [ Homo sapiens ]
• Official Symbol: WNT5A
• Synonyms: WNT5A; wingless-type MMTV integration site family, member 5A; protein Wnt-5a; hWNT5A; WNT 5A protein; WNT-5A protein
• Gene ID: 7474
• mRNA Refseq: NM_001256105
• Protein Refseq: NP_001243034
• MIM: 164975
• UniProt ID: P41221