Recombinant Human WNT5A protein, His-tagged

• Cat.No.: WNT5A-1634H
• Product Overview: Recombinant full length human WNT5A protein was expressed in E. coli with C-terminus his tag. This product is for the mature full length protein. The signal peptide and propeptide are not included.

Specification

• Description: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Lyophilized
• Molecular Mass: 37 kDa
• AA Sequence: MIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCV RNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCKLEHHHHH
• Purity: >95% by SDS-PAGE
• Storage: Store at -20 centigrade. Avoid freeze-thaw cycle.
• Reconstitution: Reconstitute in water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions or stored at -20 centigrade.
• Full Length: Full L.

Gene Information

• Gene Name: Wnt family member 5A [ Homo sapiens (human) ]
• Official Symbol: WNT5A
• Synonyms: hWNT 5A; hWNT5A; Protein Wnt 5a; Protein Wnt-5a; Protein Wnt5a; Wingless type MMTV integration site family member 5A; Wnt 5a; WNT 5A protein; WNT 5A protein precursor; WNT5A; WNT5A protein precursor; WNT5A_HUMAN
• Gene ID: 7474