Recombinant Human WNT3, StrepII-tagged
Cat.No. : | WNT3-205H |
Product Overview : | Purified, full-length human recombinant WNT3 protein (amino acids 22-355, 334 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 37.5 kDa. (Accession NP_110380.1; UniProt P56703) |
- Specification
- Gene Information
- Related Products
- Download
Description : | The WNT family consists of structurally related signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT gene family which shows 98% amino acid identity to mouse Wnt3 protein, and 84% to human WNT3A protein, another WNT gene product. The mouse studies show the requirement of Wnt3 in primary axis formation in the mouse. Studies of the gene expression suggest that this gene may play a key role in some cases of human breast, rectal, lung, and gastric cancer through activation of the WNT-beta-catenin-TCF signaling pathway. |
Source : | Human Cells |
Species : | Human |
Tag : | StrepII |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
Protein length : | 22-355, 334 a.a. |
AA Sequence : | GYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDD SLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSRE FADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVV EKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNT RTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | WNT3 wingless-type MMTV integration site family, member 3 [ Homo sapiens ] |
Official Symbol | WNT3 |
Synonyms | WNT3; wingless-type MMTV integration site family, member 3; INT4; proto-oncogene Wnt-3; MGC131950; MGC138321; MGC138323; WNT 3 proto oncogene protein; WNT-3 proto-oncogene protein; proto-oncogene Int-4 homolog; |
Gene ID | 7473 |
mRNA Refseq | NM_030753 |
Protein Refseq | NP_110380 |
MIM | 165330 |
UniProt ID | P56703 |
Chromosome Location | 17q21-q22 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function | frizzled binding; frizzled-2 binding; protein domain specific binding; receptor agonist activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All WNT3 Products
Required fields are marked with *
My Review for All WNT3 Products
Required fields are marked with *
0
Inquiry Basket