Recombinant Human WNT3, StrepII-tagged

Cat.No. : WNT3-205H
Product Overview : Purified, full-length human recombinant WNT3 protein (amino acids 22-355, 334 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 37.5 kDa. (Accession NP_110380.1; UniProt P56703)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 22-355, 334 a.a.
Description : The WNT family consists of structurally related signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT gene family which shows 98% amino acid identity to mouse Wnt3 protein, and 84% to human WNT3A protein, another WNT gene product. The mouse studies show the requirement of Wnt3 in primary axis formation in the mouse. Studies of the gene expression suggest that this gene may play a key role in some cases of human breast, rectal, lung, and gastric cancer through activation of the WNT-beta-catenin-TCF signaling pathway.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
AA Sequence : GYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDD SLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSRE FADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVV EKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNT RTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name WNT3 wingless-type MMTV integration site family, member 3 [ Homo sapiens ]
Official Symbol WNT3
Synonyms WNT3; wingless-type MMTV integration site family, member 3; INT4; proto-oncogene Wnt-3; MGC131950; MGC138321; MGC138323; WNT 3 proto oncogene protein; WNT-3 proto-oncogene protein; proto-oncogene Int-4 homolog;
Gene ID 7473
mRNA Refseq NM_030753
Protein Refseq NP_110380
MIM 165330
UniProt ID P56703
Chromosome Location 17q21-q22
Pathway Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function frizzled binding; frizzled-2 binding; protein domain specific binding; receptor agonist activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WNT3 Products

Required fields are marked with *

My Review for All WNT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon