Recombinant Human WNT3, GST-tagged
Cat.No. : | WNT3-5161H |
Product Overview : | Recombinant Human WNT3 encoding human full-length ORF(1 a.a. - 385 a.a.), fused a GST-tag at N-treminal was expressed in Wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | WNT3 belongs to the Wnt family of signaling proteins that play a key role in maintaining the integrity of embryonic and adult tissues. Expression of WNT3 occurs primarily along the dorsal midline across overlapping regions of the Central Nervous System (CNS). WNT3 signaling is essential for various morphogenetic events including embryonic patterning, cell determination, cell proliferation, CNS development, and cytoskeletal formation. |
Purification : | Glutathione Sepharose 4 Fast Flow |
Formulation : | Liquid. 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Sequence : | MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKL GIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPP GEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKT CWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETG SFGTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | WNT3 |
Gene Name | WNT3 wingless-type MMTV integration site family, member 3 [ Homo sapiens ] |
Synonyms | wingless-type MMTV integration site family, member 3; INT4; Proto-oncogene Int-4 homolog; MGC131950; MGC138321; MGC138323; Proto oncogene Int 4 homolog; Proto oncogene Wnt 3; Wnt 3 proto oncogene protein; WNT 3 proto oncogene protein precursor |
Gene ID | 7473 |
mRNA Refseq | NM_030753.3 |
Protein Refseq | NP_110380.1 |
MIM | 165330 |
UniProt ID | P56703 |
Chromosome Location | 17q21 |
Pathway | Basal cell carcinoma; Class B/2 (Secretin family receptors); DNA damage response (only ATM dependent); GPCR ligand binding; HTLV-I infection; Hedgehog signaling pathway; Melanogenesis; Pathways in cancer; Signaling by GPCR; Wnt Signaling Pathway; Wnt Signaling Pathway Net-Path; Wnt Signaling Pathway and Pluripotency; Wnt signaling network |
Function | Frizzled binding; Frizzled-2 binding; Protein domain specific binding; receptor agonist activity |
◆ Recombinant Proteins | ||
WNT3-3076H | Recombinant Human WNT3 protein, His-tagged | +Inquiry |
WNT3-5164M | Recombinant Mouse WNT3 Protein, His-tagged | +Inquiry |
WNT3-5161H | Recombinant Human WNT3, GST-tagged | +Inquiry |
WNT3-5163M | Recombinant Mouse WNT3 Protein, His-SUMO-tagged | +Inquiry |
WNT3-3738H | Recombinant Human WNT3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT3-296HCL | Recombinant Human WNT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Wnt3 Products
Required fields are marked with *
My Review for All Wnt3 Products
Required fields are marked with *
0
Inquiry Basket