Recombinant Human WNT16, StrepII-tagged

• Cat.No.: WNT16-243H
• Product Overview: Purified, full-length human recombinant WNT16 protein (amino acids 30-365, 336 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 37.6 kDa. (Accession NP_476509.1; UniProt Q9UBV4)

Specification

• Description: Wnt16 is a ligand for members of the frizzled family of seven transmembrane receptors. It may be a signaling molecule which affects the development of discrete regions of tissues. The protein Is likely to signal over only few cell diameters.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 30-365, 336 a.a.
• AA Sequence: NWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKE TAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVA KLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSE GADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: WNT16 wingless-type MMTV integration site family, member 16 [ Homo sapiens ]
• Official Symbol: WNT16
• Synonyms: WNT16; wingless-type MMTV integration site family, member 16; protein Wnt-16; wingless-type MMTV integration site family member 16b
• Gene ID: 51384
• mRNA Refseq: NM_016087
• Protein Refseq: NP_057171
• MIM: 606267
• UniProt ID: Q9UBV4
• Chromosome Location: 7q31
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem
• Function: frizzled binding; receptor binding