Recombinant Human WNT11, StrepII-tagged

Cat.No. : WNT11-242H
Product Overview : Purified, full-length human recombinant WNT11 protein (amino acids 25-354, 330 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 36.6 kDa. (Accession NP_004617.2; UniProt O96014)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 25-354, 330 a.a.
Description : The WNT family consists of structurally related signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT family. This proein may play roles in the development of skeleton, kidney and lung, and is considered to be a plausible candidate gene for High Bone Mass Syndrome.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
AA Sequence : IKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFV YALSAAAISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCKC HGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSC DLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
Endotoxin : <0.1 eu per ug protein by lal
Purity : >80% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name WNT11 wingless-type MMTV integration site family, member 11 [ Homo sapiens ]
Official Symbol WNT11
Synonyms HWNT11
Gene ID 7481
mRNA Refseq NM_004626.2
Protein Refseq NP_004617.2
MIM 603699
UniProt ID O96014
Chromosome Location 11q13.5
Pathway Basal cell carcinoma, organism-specific biosystem;Basal cell carcinoma, conserved biosystem;Class B/2 (Secretin family receptors), organism-specific biosystem;DNA damage response (only ATM dependent), organism-specific biosystem;GPCR ligand binding, organism-specific biosystem;HTLV-I infection, organism-specific biosystem;HTLV-I infection, conserved biosystem;
Function G-protein coupled receptor binding;Ras GTPase activator activity;protein kinase activator activity;transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WNT11 Products

Required fields are marked with *

My Review for All WNT11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon