Recombinant Human WNT11, StrepII-tagged
Cat.No. : | WNT11-242H |
Product Overview : | Purified, full-length human recombinant WNT11 protein (amino acids 25-354, 330 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 36.6 kDa. (Accession NP_004617.2; UniProt O96014) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 25-354, 330 a.a. |
Description : | The WNT family consists of structurally related signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This protein is a member of the WNT family. This proein may play roles in the development of skeleton, kidney and lung, and is considered to be a plausible candidate gene for High Bone Mass Syndrome. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | IKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFV YALSAAAISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCKC HGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSC DLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >80% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | WNT11 wingless-type MMTV integration site family, member 11 [ Homo sapiens ] |
Official Symbol | WNT11 |
Synonyms | HWNT11 |
Gene ID | 7481 |
mRNA Refseq | NM_004626.2 |
Protein Refseq | NP_004617.2 |
MIM | 603699 |
UniProt ID | O96014 |
Chromosome Location | 11q13.5 |
Pathway | Basal cell carcinoma, organism-specific biosystem;Basal cell carcinoma, conserved biosystem;Class B/2 (Secretin family receptors), organism-specific biosystem;DNA damage response (only ATM dependent), organism-specific biosystem;GPCR ligand binding, organism-specific biosystem;HTLV-I infection, organism-specific biosystem;HTLV-I infection, conserved biosystem; |
Function | G-protein coupled receptor binding;Ras GTPase activator activity;protein kinase activator activity;transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
WNT11-113H | Active Recombinant Human WNT11 Protein | +Inquiry |
WNT11-12H | Recombinant Human WNT11 Protein (Full Length), N-GST and C-His-tagged | +Inquiry |
WNT11-18566M | Recombinant Mouse WNT11 Protein | +Inquiry |
WNT11-553H | Active Recombinant Human WNT11 | +Inquiry |
WNT11-3737H | Recombinant Human WNT11, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT11-301HCL | Recombinant Human WNT11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT11 Products
Required fields are marked with *
My Review for All WNT11 Products
Required fields are marked with *
0
Inquiry Basket