Recombinant Human Wnt family member 9A Protein, His tagged

• Cat.No.: WNT9A-001H
• Product Overview: Recombinant Human Wnt family member 9A protein (48-92 aa & 231-304 aa) with His tag was expressed in E. coli.

Specification

• Description: The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is expressed in gastric cancer cell lines. The protein encoded by this gene shows 75 % amino acid identity to chicken Wnt14, which has been shown to play a central role in initiating synovial joint formation in the chick limb. This gene is clustered with another family member, WNT3A, in the chromosome 1q42 region.
• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: 48-92 aa & 231-304 aa
• Molecular Mass: 13 kDa
• AA Sequence: MPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALERQLAPFHEVGKHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCLAGRFHHHHHHHH
• Endotoxin: < 2 EU/μg by LAL.
• Purity: > 65 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 0.4 mg/mL

Gene Information

• Gene Name: WNT9A Wnt family member 9A [ Homo sapiens (human) ]
• Official Symbol: WNT9A
• Synonyms: WNT9A; Wnt family member 9A; WNT14; protein Wnt-9a; wingless-type MMTV integration site family, member 14; wingless-type MMTV integration site family, member 9A
• Gene ID: 7483
• mRNA Refseq: NM_003395.2
• Protein Refseq: NP_003386.1
• MIM: 602863
• UniProt ID: O14904