Recombinant Human WISP2 protein, GST-tagged

• Cat.No.: WISP2-4630H
• Product Overview: Recombinant Human WISP2 protein(O76076)(1-250aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.3 kDa
• Protein length: 1-250aa
• AA Sequence: MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: WISP2 WNT1 inducible signaling pathway protein 2 [ Homo sapiens ]
• Official Symbol: WISP2
• Synonyms: WISP2; WNT1 inducible signaling pathway protein 2; WNT1-inducible-signaling pathway protein 2; CCN5; CT58; CTGF L; WISP-2; CCN family member 5; wnt-1 signaling pathway protein 2; connective tissue growth factor-like protein; connective tissue growth factor-related protein 58; CTGF-L
• Gene ID: 8839
• mRNA Refseq: NM_003881
• Protein Refseq: NP_003872
• MIM: 603399
• UniProt ID: O76076