Recombinant Human WHSC2, His-tagged
Cat.No. : | WHSC2-30860TH |
Product Overview : | Recombinant full length Human WHSC2 (amino acids 1-539) with an N terminal His tag; 569 amino acids with tag, Predicted MWt 60.6kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 539 amino acids |
Description : | This gene is expressed ubiquitously with higher levels in fetal than in adult tissues. It encodes a protein sharing 93% sequence identity with the mouse protein. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene is mapped to the 165 kb WHS critical region, and may play a role in the phenotype of the WHS or Pitt-Rogers-Danks syndrome. The encoded protein is found to be capable of reacting with HLA-A2-restricted and tumor-specific cytotoxic T lymphocytes, suggesting a target for use in specific immunotherapy for a large number of cancer patients. This protein has also been shown to be a member of the NELF (negative elongation factor) protein complex that participates in the regulation of RNA polymerase II transcription elongation. |
Conjugation : | HIS |
Molecular Weight : | 60.600kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 1.17% Sodium chloride, 0.08% DTT, 0.03% EDTA, 20% Glycerol |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPGQRRALSPKMASMRESDT GLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLS SAVKLKLLLGTLHLPRRTVDEMKGALMEIIQLASLDSDPW VLMVADILKSFPDTGSLNLELEEQNPNVQDILGELREKVG ECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKP KSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMD TTTPLKGIPKQAPFRSPTAPSVFSPTGNRTPIPPSRTLLR KERGVKLLDISELDMVGAGREAKRRRKTLDAEVVEKPAKE ETVVENATPDYAAGLVSTQKLGSLNNEPALPSTSYLPSTP SVVPASSYIPSSETPPAPSSREASRPPEEPSAPSPTLPAQ FKQRAPMYNSGLSPATPTPAAPTSPLTPTTPPAVAPTTQT PPVAMVAPQTQAPAQQQPKKNLSLTREQMFAAQEMFKTAN KVTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDL PKADGQGSTTMLVDTVFEMNYATGQWTRFKKYKPMTNVS |
Gene Name | WHSC2 Wolf-Hirschhorn syndrome candidate 2 [ Homo sapiens ] |
Official Symbol | WHSC2 |
Synonyms | WHSC2; Wolf-Hirschhorn syndrome candidate 2; negative elongation factor A; NELF A; |
Gene ID | 7469 |
mRNA Refseq | NM_005663 |
Protein Refseq | NP_005654 |
MIM | 606026 |
Uniprot ID | Q9H3P2 |
Chromosome Location | 4p16.3 |
Pathway | Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; |
◆ Recombinant Proteins | ||
WHSC2-18547M | Recombinant Mouse WHSC2 Protein | +Inquiry |
WHSC2-30860TH | Recombinant Human WHSC2, His-tagged | +Inquiry |
WHSC2-3397H | Recombinant Human Wolf-Hirschhorn Syndrome Candidate 2, His-tagged | +Inquiry |
WHSC2-3015H | Recombinant Human Wolf-Hirschhorn Syndrome Candidate 2, T7-tagged | +Inquiry |
WHSC2-10179M | Recombinant Mouse WHSC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WHSC2-1932HCL | Recombinant Human WHSC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WHSC2 Products
Required fields are marked with *
My Review for All WHSC2 Products
Required fields are marked with *
0
Inquiry Basket