Recombinant Human WFDC10A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | WFDC10A-3742H |
Product Overview : | WFDC10A MS Standard C13 and N15-labeled recombinant protein (NP_542791) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 8.9 kDa |
AA Sequence : | MAPQTLLPVLVLCVLLLQAQGGYRDKKRMQKTQLSPEIKVCQQQPKLYLCKHLCESHRDCQANNICCSTYCGNVCMSILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | WFDC10A WAP four-disulfide core domain 10A [ Homo sapiens (human) ] |
Official Symbol | WFDC10A |
Synonyms | WFDC10A; WAP four-disulfide core domain 10A; WAP10; C20orf146; dJ688G8.3; WAP four-disulfide core domain protein 10A; putative protease inhibitor WAP10A |
Gene ID | 140832 |
mRNA Refseq | NM_080753 |
Protein Refseq | NP_542791 |
UniProt ID | Q9H1F0 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All WFDC10A Products
Required fields are marked with *
My Review for All WFDC10A Products
Required fields are marked with *
0
Inquiry Basket