Recombinant Human WDR61 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: WDR61-140H
• Product Overview: WDR61 MS Standard C13 and N15-labeled recombinant protein (NP_079510) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance.
• Molecular Mass: 33.6 kDa
• AA Sequence: MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYDCPITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: WDR61 WD repeat domain 61 [ Homo sapiens (human) ]
• Official Symbol: WDR61
• Synonyms: REC14; SKI8; WD repeat-containing protein 61; SKI8 homolog; meiotic recombination REC14 protein homolog; recombination protein REC14
• Gene ID: 80349
• mRNA Refseq: NM_025234
• Protein Refseq: NP_079510
• MIM: 609540
• UniProt ID: Q9GZS3