Recombinant Human WDR45L, His-tagged

Cat.No. : WDR45L-31542TH
Product Overview : Recombinant fragment, corresponding to amino acids 139-344 of Human WDR45L with N terminal His tag; 206 amino acids, 25kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 139-344 a.a.
Description : This gene encodes a member of the WIPI or SVP1 family of WD40 repeat-containing proteins. The protein contains seven WD40 repeats that are thought to fold into a beta-propeller structure that mediates protein-protein interactions, and a conserved motif for interaction with phospholipids. The human genome contains several pseudogenes of this gene.
Conjugation : HIS
Tissue specificity : Ubiquitously expressed. Highly expressed in heart, skeletal muscle and pancreas. Up-regulated in a variety of tumor tissues including ovarian and uterine cancers.
Form : Lyophilised:Reconstitute with 104 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPP VDIPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTS SGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHI FAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSG SPCICAFGTEPNAVIAICADGSYYKFLFNPKGECIRDV YAQFLEMTDDKL
Sequence Similarities : Belongs to the WD repeat SVP1 family.Contains 2 WD repeats.
Gene Name WDR45L WDR45-like [ Homo sapiens ]
Official Symbol WDR45L
Synonyms WDR45L; WDR45-like; WD repeat domain phosphoinositide-interacting protein 3; WIPI3;
Gene ID 56270
mRNA Refseq NM_019613
Protein Refseq NP_062559
MIM 609226
Uniprot ID Q5MNZ6
Chromosome Location 17q25.3
Function phosphatidylinositol-3,5-bisphosphate binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All WDR45L Products

Required fields are marked with *

My Review for All WDR45L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon