Recombinant Human WDR45L, His-tagged
Cat.No. : | WDR45L-31542TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 139-344 of Human WDR45L with N terminal His tag; 206 amino acids, 25kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 139-344 a.a. |
Description : | This gene encodes a member of the WIPI or SVP1 family of WD40 repeat-containing proteins. The protein contains seven WD40 repeats that are thought to fold into a beta-propeller structure that mediates protein-protein interactions, and a conserved motif for interaction with phospholipids. The human genome contains several pseudogenes of this gene. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitously expressed. Highly expressed in heart, skeletal muscle and pancreas. Up-regulated in a variety of tumor tissues including ovarian and uterine cancers. |
Form : | Lyophilised:Reconstitute with 104 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPP VDIPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTS SGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHI FAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSG SPCICAFGTEPNAVIAICADGSYYKFLFNPKGECIRDV YAQFLEMTDDKL |
Sequence Similarities : | Belongs to the WD repeat SVP1 family.Contains 2 WD repeats. |
Gene Name | WDR45L WDR45-like [ Homo sapiens ] |
Official Symbol | WDR45L |
Synonyms | WDR45L; WDR45-like; WD repeat domain phosphoinositide-interacting protein 3; WIPI3; |
Gene ID | 56270 |
mRNA Refseq | NM_019613 |
Protein Refseq | NP_062559 |
MIM | 609226 |
Uniprot ID | Q5MNZ6 |
Chromosome Location | 17q25.3 |
Function | phosphatidylinositol-3,5-bisphosphate binding; |
◆ Recombinant Proteins | ||
WDR45L-3716H | Recombinant Human WDR45L, GST-tagged | +Inquiry |
WDR45L-31542TH | Recombinant Human WDR45L, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WDR45L Products
Required fields are marked with *
My Review for All WDR45L Products
Required fields are marked with *
0
Inquiry Basket