Recombinant Human WDR1 protein(311-380 aa), N-MBP & C-His-tagged

• Cat.No.: WDR1-2480H
• Product Overview: Recombinant Human WDR1 protein(O75083)(311-380 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&MBP
• Protein Length: 311-380 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLI

Gene Information

• Gene Name: WDR1 WD repeat domain 1 [ Homo sapiens ]
• Official Symbol: WDR1
• Synonyms: WDR1; WD repeat domain 1; WD repeat-containing protein 1; actin-interacting protein 1; AIP1; NORI-1
• Gene ID: 9948
• mRNA Refseq: NM_005112
• Protein Refseq: NP_005103
• MIM: 604734
• UniProt ID: O75083