Recombinant Human WBP2NL Protein, GST-tagged

• Cat.No.: WBP2NL-4337H
• Product Overview: Human MGC26816 full-length ORF ( AAH22546, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: WBP2NL is a sperm-specific WW domain-binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization (Wu et al., 2007 [PubMed 17289678]).[supplied by OMIM
• Molecular Mass: 59.73 kDa
• AA Sequence: MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASAAARGFPLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGYRASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLPSASSSQVHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: WBP2NL WBP2 N-terminal like [ Homo sapiens ]
• Official Symbol: WBP2NL
• Synonyms: WBP2NL; WBP2 N-terminal like; postacrosomal sheath WW domain-binding protein; FLJ26145; MGC26816; PAWP; postacrosomal sheath WW domain binding protein; WW domain-binding protein 2-like
• Gene ID: 164684
• mRNA Refseq: NM_152613
• Protein Refseq: NP_689826
• MIM: 610981
• UniProt ID: Q6ICG8