Recombinant Human WASL Protein, His tagged

• Cat.No.: WASL-001H
• Product Overview: Recombinant Human WASL Protein (21-270 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Non
• Protein Length: 21-270 aa
• Description: This gene encodes a member of the Wiskott-Aldrich syndrome (WAS) protein family. Wiskott-Aldrich syndrome proteins share similar domain structure, and associate with a variety of signaling molecules to alter the actin cytoskeleton. The encoded protein is highly expressed in neural tissues, and interacts with several proteins involved in cytoskeletal organization, including cell division control protein 42 (CDC42) and the actin-related protein-2/3 (ARP2/3) complex. The encoded protein may be involved in the formation of long actin microspikes, and in neurite extension.
• Molecular Mass: 30 kDa
• Purity: > 85% by SDS-PAGE
• AA Sequence: MLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNHHHHHHHH
• Endotoxin: < 1.0 EU/μg by LAL
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol
• Concentration: 0.7 mg/mL by BCA

Gene Information

• Gene Name: WASL WASP like actin nucleation promoting factor [ Homo sapiens (human) ]
• Official Symbol: WASL
• Synonyms: WASL; Wiskott-Aldrich syndrome-like; neural Wiskott-Aldrich syndrome protein; N WASP; NWASP; Wiskott-Aldrich syndrome gene-like; N-WASP; MGC48327; DKFZp779G0847
• Gene ID: 8976
• mRNA Refseq: NM_003941
• Protein Refseq: NP_003932
• MIM: 605056
• UniProt ID: O00401