Recombinant Human WASHC3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: WASHC3-5805H
• Product Overview: CCDC53 MS Standard C13 and N15-labeled recombinant protein (NP_057137) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: WASHC3 (WASH Complex Subunit 3) is a Protein Coding gene. Diseases associated with WASHC3 include Ritscher-Schinzel Syndrome and Spastic Paraplegia 8, Autosomal Dominant. Among its related pathways are Endocytosis.
• Molecular Mass: 21.1 kDa
• AA Sequence: MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQSSTQDSGLQESEVSAENILTVAKDPRYARYLKMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: WASHC3 WASH complex subunit 3 [ Homo sapiens (human) ]
• Official Symbol: WASHC3
• Synonyms: WASHC3; WASH complex subunit 3; CCDC53; CGI-116; WASH complex subunit 3; WASH complex subunit CCDC53; coiled-coil domain containing 53; coiled-coil domain-containing protein 53
• Gene ID: 51019
• mRNA Refseq: NM_016053
• Protein Refseq: NP_057137
• UniProt ID: Q9Y3C0