Recombinant Human VWA5B2 Protein (781-862 aa), His-SUMO-tagged

• Cat.No.: VWA5B2-1063H
• Product Overview: Recombinant Human VWA5B2 Protein (781-862 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 781-862 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 24.6 kDa
• AA Sequence: PRKPSLGAILDGPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCHVVIRGLCGEQP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: VWA5B2 von Willebrand factor A domain containing 5B2 [ Homo sapiens (human) ]
• Official Symbol: VWA5B2
• Gene ID: 90113
• UniProt ID: Q8N398