Recombinant Human VTCN1 protein, T7/His-tagged

• Cat.No.: VTCN1-116H
• Product Overview: Recombinant human VTCN1 extracellular domain cDNA (25-259aa, Isoform-1, derived from BC074729) fused with T7/His/TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• ProteinLength: 25-259 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGEFLIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQW LKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYK TGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINN TYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAS
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro VTCN1 mediated T cell differentiation regulation study with this protein as either soluble factor or coating matrix protein.2. May be used for mapping VTCN1 protein-protein interaction assay.3. Potential biomarker protein for clinical applications such as monitoring pancreatic cancer progression.4. As antigen for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: VTCN1 V-set domain containing T cell activation inhibitor 1 [ Homo sapiens ]
• Official Symbol: VTCN1
• Synonyms: VTCN1; V-set domain containing T cell activation inhibitor 1; V-set domain-containing T-cell activation inhibitor 1; B7 family member; H4; B7 superfamily member 1; B7 H4; B7H4; B7S1; B7X; FLJ22418; B7 family member, H4; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; immune costimulatory protein B7-H4; B7-H4; B7h.5; VCTN1; PRO1291; RP11-229A19.4
• Gene ID: 79679
• mRNA Refseq: NM_001253849
• Protein Refseq: NP_001240778
• MIM: 608162
• UniProt ID: Q7Z7D3
• Chromosome Location: 1p12
• Function: receptor binding