Recombinant Human VTCN1 Protein

• Cat.No.: VTCN1-604H
• Product Overview: Recombinant human VTCN1 protein without tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• ProteinLength: 282
• Description: This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene.
• Form: Lyophilized
• Molecular Mass: 26.1 kDa
• AA Sequence: MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: VTCN1 V-set domain containing T cell activation inhibitor 1 [ Homo sapiens (human) ]
• Official Symbol: VTCN1
• Synonyms: VTCN1; V-set domain containing T cell activation inhibitor 1; V-set domain-containing T-cell activation inhibitor 1; B7 family member; H4; B7 superfamily member 1; B7 H4; B7H4; B7S1; B7X; FLJ22418; B7 family member, H4; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; immune costimulatory protein B7-H4; B7-H4; B7h.5; VCTN1; PRO1291; RP11-229A19.4
• Gene ID: 79679
• mRNA Refseq: NM_001253849
• Protein Refseq: NP_001240778
• MIM: 608162
• UniProt ID: Q7Z7D3