Recombinant Human VSX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: VSX1-3188H
• Product Overview: VSX1 MS Standard C13 and N15-labeled recombinant protein (NP_955457) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The protein encoded by this gene contains a paired-like homeodomain and binds to the core of the locus control region of the red/green visual pigment gene cluster. The encoded protein may regulate expression of the cone opsin genes early in development. Mutations in this gene can cause posterior polymorphous corneal dystrophy and keratoconus. Alternatively spliced transcript variants encoding different isoforms have been described.
• Molecular Mass: 24.8 kDa
• AA Sequence: MTGRDSLSDGRTSSRALVPGGSPRGSRPRGFAITDLLGLEAELPAPAGPGQGSGCEGPAVAPCPGPGLDGSSLARGALPLGLGLLCGFGTQPPAAARAPCLLLADVPFLPPRGPEPAAPLAPSRPPPALGRQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVSGVPFLRSKDTTENVSFPHSVSQSAVPSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: VSX1 visual system homeobox 1 [ Homo sapiens (human) ]
• Official Symbol: VSX1
• Synonyms: VSX1; visual system homeobox 1; posterior polymorphous corneal dystrophy, PPCD, visual system homeobox 1 homolog, CHX10 like (zebrafish); PPD; homeodomain protein RINX; transcription factor VSX1; retinal inner nuclear layer homeobox protein; KTCN; PPCD; RINX; KTCN1; CAASDS
• Gene ID: 30813
• mRNA Refseq: NM_199425
• Protein Refseq: NP_955457
• MIM: 605020
• UniProt ID: Q9NZR4