Recombinant Human VSTM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: VSTM1-5796H
• Product Overview: VSTM1 MS Standard C13 and N15-labeled recombinant protein (NP_940883) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Isoform 1: Inhibitory immune receptor involved in the regulation of phagocytes.
• Molecular Mass: 24.4 kDa
• AA Sequence: MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAIFSCISILLLFLSVFIIYRCSQHGSSSEESTKRTSHSKLPEXEAAEADLSNMERVSLSTADPQGVTYAELSTSALSEAASDTTQEPPGSHEYAALKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: VSTM1 V-set and transmembrane domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: VSTM1
• Synonyms: VSTM1; V-set and transmembrane domain containing 1; SIRL1; SIRL-1; UNQ3033; V-set and transmembrane domain-containing protein 1; LAIR homolog; OSCAR-like transcript-1; signal inhibitory receptor on leukocytes-1
• Gene ID: 284415
• mRNA Refseq: NM_198481
• Protein Refseq: NP_940883
• MIM: 616804
• UniProt ID: Q6UX27